Lineage for d2grmb2 (2grm B:67-315)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339718Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2339910Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins)
  6. 2339939Protein automated matches [254479] (1 species)
    not a true protein
  7. 2339940Species Enterococcus faecalis [TaxId:1351] [255040] (5 PDB entries)
  8. 2339950Domain d2grmb2: 2grm B:67-315 [147164]
    Other proteins in same PDB: d2grma1, d2grma2, d2grmb1, d2grmc1
    automated match to d2awia2

Details for d2grmb2

PDB Entry: 2grm (more details), 3 Å

PDB Description: crystal structure of prgx/icf10 complex
PDB Compounds: (B:) PrgX

SCOPe Domain Sequences for d2grmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grmb2 a.118.8.4 (B:67-315) automated matches {Enterococcus faecalis [TaxId: 1351]}
mntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynie
vptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdy
dltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingcydleinylkqiyqfl
tdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyvaie
nnpipeike

SCOPe Domain Coordinates for d2grmb2:

Click to download the PDB-style file with coordinates for d2grmb2.
(The format of our PDB-style files is described here.)

Timeline for d2grmb2: