Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (10 families) |
Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins) |
Protein automated matches [254479] (1 species) not a true protein |
Species Enterococcus faecalis [TaxId:1351] [255040] (5 PDB entries) |
Domain d2grmb2: 2grm B:67-315 [147164] Other proteins in same PDB: d2grma1, d2grma2, d2grmb1, d2grmc1 automated match to d2awia2 |
PDB Entry: 2grm (more details), 3 Å
SCOPe Domain Sequences for d2grmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grmb2 a.118.8.4 (B:67-315) automated matches {Enterococcus faecalis [TaxId: 1351]} mntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynie vptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdy dltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingcydleinylkqiyqfl tdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyvaie nnpipeike
Timeline for d2grmb2:
View in 3D Domains from other chains: (mouse over for more information) d2grma1, d2grma2, d2grmc1, d2grmc2 |