Lineage for d2grmb2 (2grm B:70-315)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1279354Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1279476Family a.118.8.4: PrgX C-terminal domain-like [140848] (1 protein)
  6. 1279477Protein PrgX [140849] (1 species)
  7. 1279478Species Enterococcus faecalis [TaxId:1351] [140850] (7 PDB entries)
    Uniprot Q04114 70-287! Uniprot Q04114 71-301
  8. 1279514Domain d2grmb2: 2grm B:70-315 [147164]
    Other proteins in same PDB: d2grma1, d2grmb1
    automatically matched to 2GRM A:70-315

Details for d2grmb2

PDB Entry: 2grm (more details), 3 Å

PDB Description: crystal structure of prgx/icf10 complex
PDB Compounds: (B:) PrgX

SCOPe Domain Sequences for d2grmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grmb2 a.118.8.4 (B:70-315) PrgX {Enterococcus faecalis [TaxId: 1351]}
ksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievpt
fnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdydlt
iqtvlknaltisimnrnlkeaqyyinqfehlktiknisingcydleinylkqiyqfltdk
nidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyvaiennp
ipeike

SCOPe Domain Coordinates for d2grmb2:

Click to download the PDB-style file with coordinates for d2grmb2.
(The format of our PDB-style files is described here.)

Timeline for d2grmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2grmb1