Lineage for d2grmb1 (2grm B:1-66)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709766Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 2709767Protein automated matches [190907] (21 species)
    not a true protein
  7. 2709830Species Enterococcus faecalis [TaxId:1351] [255039] (5 PDB entries)
  8. 2709839Domain d2grmb1: 2grm B:1-66 [147163]
    Other proteins in same PDB: d2grma1, d2grma2, d2grmb2, d2grmc2
    automated match to d2awia1

Details for d2grmb1

PDB Entry: 2grm (more details), 3 Å

PDB Description: crystal structure of prgx/icf10 complex
PDB Compounds: (B:) PrgX

SCOPe Domain Sequences for d2grmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grmb1 a.35.1.0 (B:1-66) automated matches {Enterococcus faecalis [TaxId: 1351]}
mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
ilnrag

SCOPe Domain Coordinates for d2grmb1:

Click to download the PDB-style file with coordinates for d2grmb1.
(The format of our PDB-style files is described here.)

Timeline for d2grmb1: