Lineage for d2grma1 (2grm A:1-69)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1488831Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1488832Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1489237Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein)
    Part of Pfam PF01381
  6. 1489238Protein PrgX [140527] (1 species)
    possibly involved in pheromone-inducible conjugation
  7. 1489239Species Enterococcus faecalis [TaxId:1351] [140528] (4 PDB entries)
    Uniprot Q04114 1-69! Uniprot Q04114 2-66
  8. 1489265Domain d2grma1: 2grm A:1-69 [147161]
    Other proteins in same PDB: d2grma2, d2grmb1, d2grmb2, d2grmc1, d2grmc2

Details for d2grma1

PDB Entry: 2grm (more details), 3 Å

PDB Description: crystal structure of prgx/icf10 complex
PDB Compounds: (A:) PrgX

SCOPe Domain Sequences for d2grma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grma1 a.35.1.11 (A:1-69) PrgX {Enterococcus faecalis [TaxId: 1351]}
mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
ilnragmnt

SCOPe Domain Coordinates for d2grma1:

Click to download the PDB-style file with coordinates for d2grma1.
(The format of our PDB-style files is described here.)

Timeline for d2grma1: