Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.14: NSP3A-like [159936] (1 family) short helical inserions in the common fold |
Family d.15.14.1: NSP3A-like [159937] (1 protein) |
Protein Nsp3 [159938] (1 species) |
Species SARS coronavirus [TaxId:227859] [159939] (2 PDB entries) Uniprot P59641 819-930 |
Domain d2gria1: 2gri A:1-112 [147160] |
PDB Entry: 2gri (more details)
SCOPe Domain Sequences for d2gria1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gria1 d.15.14.1 (A:1-112) Nsp3 {SARS coronavirus [TaxId: 227859]} apikgvtfgedtvwevqgyknvritfeldervdkvlnekcsvytvesgtevtefacvvae avvktlqpvsdlltnmgidldewsvatfylfddageenfssrmycsfyppde
Timeline for d2gria1: