SCOPe 2.06: Domain d2gria1: 2gri A:1-112

Lineage for d2gria1 (2gri A:1-112)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.14: NSP3A-like [159936] (1 family)
   short helical inserions in the common fold

5. Family d.15.14.1: NSP3A-like [159937] (1 protein)

6. Protein Nsp3 [159938] (1 species)

7. Species SARS coronavirus [TaxId:227859] [159939] (2 PDB entries)
   Uniprot P59641 819-930

8. Domain d2gria1: 2gri A:1-112 [147160]

Details for d2gria1

PDB Entry: 2gri

PDB Description: nmr structure of the sars-cov non-structural protein nsp3a

PDB Compounds: (A:) nsp3

SCOPe Domain Sequences for d2gria1:

Sequence; same for both SEQRES and ATOM records:

>d2gria1 d.15.14.1 (A:1-112) Nsp3 {SARS coronavirus [TaxId: 227859]}
apikgvtfgedtvwevqgyknvritfeldervdkvlnekcsvytvesgtevtefacvvae
avvktlqpvsdlltnmgidldewsvatfylfddageenfssrmycsfyppde

Timeline for d2gria1:

• d2gria1 first appeared in SCOP 1.75
  
• d2gria1 appears in SCOPe 2.05
  
• d2gria1 appears in SCOPe 2.07
  
• d2gria1 appears in the current release, SCOPe 2.08