Lineage for d2grga1 (2grg A:2-98)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2577749Superfamily d.110.10: YNR034W-A-like [160683] (1 family) (S)
    automatically mapped to Pfam PF11503
  5. 2577750Family d.110.10.1: YNR034W-A-like [160684] (1 protein)
  6. 2577751Protein Uncharacterized protein YNR034W-A [160685] (1 species)
  7. 2577752Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [160686] (1 PDB entry)
    Uniprot Q3E841 1-98
  8. 2577753Domain d2grga1: 2grg A:2-98 [147159]
    Other proteins in same PDB: d2grga2

Details for d2grga1

PDB Entry: 2grg (more details)

PDB Description: solution nmr structure of protein ynr034w-a from saccharomyces cerevisiae. northeast structural genomics consortium target yt727; ontario center for structural proteomics target yst6499.
PDB Compounds: (A:) hypothetical protein; Ynr034w-ap

SCOPe Domain Sequences for d2grga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grga1 d.110.10.1 (A:2-98) Uncharacterized protein YNR034W-A {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kssipitevlpravgsltfdenynlldtsgvakviekspiaeiirksnaelgrlgysvye
daqyighafkkaghfivyftpknknregvvppvgitn

SCOPe Domain Coordinates for d2grga1:

Click to download the PDB-style file with coordinates for d2grga1.
(The format of our PDB-style files is described here.)

Timeline for d2grga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2grga2