Lineage for d2grga1 (2grg A:1-98)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870642Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 871050Superfamily d.110.10: YNR034W-A-like [160683] (1 family) (S)
  5. 871051Family d.110.10.1: YNR034W-A-like [160684] (1 protein)
  6. 871052Protein Uncharacterized protein YNR034W-A [160685] (1 species)
  7. 871053Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [160686] (1 PDB entry)
    Uniprot Q3E841 1-98
  8. 871054Domain d2grga1: 2grg A:1-98 [147159]

Details for d2grga1

PDB Entry: 2grg (more details)

PDB Description: solution nmr structure of protein ynr034w-a from saccharomyces cerevisiae. northeast structural genomics consortium target yt727; ontario center for structural proteomics target yst6499.
PDB Compounds: (A:) hypothetical protein; Ynr034w-ap

SCOP Domain Sequences for d2grga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grga1 d.110.10.1 (A:1-98) Uncharacterized protein YNR034W-A {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mkssipitevlpravgsltfdenynlldtsgvakviekspiaeiirksnaelgrlgysvy
edaqyighafkkaghfivyftpknknregvvppvgitn

SCOP Domain Coordinates for d2grga1:

Click to download the PDB-style file with coordinates for d2grga1.
(The format of our PDB-style files is described here.)

Timeline for d2grga1: