SCOPe 2.08: Domain d2grga1: 2grg A:2-98

Lineage for d2grga1 (2grg A:2-98)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.10: YNR034W-A-like [160683] (1 family)
   automatically mapped to Pfam PF11503

5. Family d.110.10.1: YNR034W-A-like [160684] (1 protein)

6. Protein Uncharacterized protein YNR034W-A [160685] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [160686] (1 PDB entry)
   Uniprot Q3E841 1-98

8. Domain d2grga1: 2grg A:2-98 [147159]
   Other proteins in same PDB: d2grga2

Details for d2grga1

PDB Entry: 2grg

PDB Description: solution nmr structure of protein ynr034w-a from saccharomyces cerevisiae. northeast structural genomics consortium target yt727; ontario center for structural proteomics target yst6499.

PDB Compounds: (A:) hypothetical protein; Ynr034w-ap

SCOPe Domain Sequences for d2grga1:

Sequence; same for both SEQRES and ATOM records:

>d2grga1 d.110.10.1 (A:2-98) Uncharacterized protein YNR034W-A {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kssipitevlpravgsltfdenynlldtsgvakviekspiaeiirksnaelgrlgysvye
daqyighafkkaghfivyftpknknregvvppvgitn

Timeline for d2grga1:

• d2grga1 first appeared in SCOP 1.75
  
• d2grga1 appears in SCOPe 2.07