SCOPe 2.08: Domain d2gqba1: 2gqb A:1-130

Lineage for d2gqba1 (2gqb A:1-130)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.282: RPA2825-like [158633] (1 superfamily)
   5 helices, array; long flexible loop between helices 1 and 2; the remaining helices are arranged similar to the PGBD-like fold (47089)

4. Superfamily a.282.1: RPA2825-like [158634] (1 family)
   automatically mapped to Pfam PF12200

5. Family a.282.1.1: RPA2825-like [158635] (1 protein)
   PfamB PB041910

6. Protein Hypothetical protein RPA2825 [158636] (1 species)

7. Species Rhodopseudomonas palustris [TaxId:1076] [158637] (1 PDB entry)
   Uniprot Q6N5Z3 1-130

8. Domain d2gqba1: 2gqb A:1-130 [147155]

Details for d2gqba1

PDB Entry: 2gqb

PDB Description: solution structure of a conserved unknown protein rpa2825 from rhodopseudomonas palustris; (northeast structural genomics consortium target rpt4; ontario centre for structural proteomics target rp2812 )

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d2gqba1:

Sequence; same for both SEQRES and ATOM records:

>d2gqba1 a.282.1.1 (A:1-130) Hypothetical protein RPA2825 {Rhodopseudomonas palustris [TaxId: 1076]}
msifgkimsaifgdsaaaspggaqapattgaagtaptapqptaapsidvapildkavkak
geklewrtsivdlmkaldidsslsarkelakelgysgdmndsasmniwlhkqvmsklvan
ggklppeikh

Timeline for d2gqba1:

• d2gqba1 first appeared in SCOP 1.75
  
• d2gqba1 appears in SCOPe 2.07