![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies) beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.100.2: MbtH-like [160582] (2 families) ![]() the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position |
![]() | Family d.100.2.1: MbtH-like [160583] (2 proteins) Pfam PF03621 |
![]() | Protein Uncharacterized protein PA2412 [160584] (2 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [160585] (1 PDB entry) Uniprot Q9I169 1-72 |
![]() | Domain d2gpfa1: 2gpf A:1-72 [147153] |
PDB Entry: 2gpf (more details)
SCOPe Domain Sequences for d2gpfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gpfa1 d.100.2.1 (A:1-72) Uncharacterized protein PA2412 {Pseudomonas aeruginosa [TaxId: 287]} mtsvfdrddiqfqvvvnheeqysiwpeykeipqgwraagksglkkdclayieevwtdmrp lslrqhmdkaag
Timeline for d2gpfa1: