SCOPe 2.05: Domain d2gomb_: 2gom B:

Lineage for d2gomb_ (2gom B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.17: Efb C-domain-like [158366] (1 family)
   automatically mapped to Pfam PF12199

5. Family a.7.17.1: Efb C-domain-like [158367] (2 proteins)
   PfamB PB008033
   this is a repeat family; one repeat unit is 2gom A:105-165 found in domain

6. Protein Fibrinogen-binding protein Efb (Fib) [158368] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [158369] (4 PDB entries)
   Uniprot A6QG59 101-165! Uniprot P68798 105-165! Uniprot P68799 101-165

8. Domain d2gomb_: 2gom B: [147150]
   automated match to d2goxb1

Details for d2gomb_

PDB Entry: 2gom, 1.25 Å

PDB Description: Crystal structure of Efb-C from Staphylococcus aureus

PDB Compounds: (B:) Fibrinogen-binding protein

SCOPe Domain Sequences for d2gomb_:

Sequence; same for both SEQRES and ATOM records:

>d2gomb_ a.7.17.1 (B:) Fibrinogen-binding protein Efb (Fib) {Staphylococcus aureus [TaxId: 1280]}
kkeqkliqaqnlvrefekthtvsahrkaqkavnlvsfeykvkkmvlqeridnvlkqglvr

Timeline for d2gomb_:

• d2gomb_ first appeared in SCOP 1.75, called d2gomb1
  
• d2gomb_ appears in SCOPe 2.04
  
• d2gomb_ appears in SCOPe 2.06
  
• d2gomb_ appears in the current release, SCOPe 2.08