Lineage for d2gomb_ (2gom B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696944Superfamily a.7.17: Efb C-domain-like [158366] (1 family) (S)
    automatically mapped to Pfam PF12199
  5. 2696945Family a.7.17.1: Efb C-domain-like [158367] (2 proteins)
    PfamB PB008033
    this is a repeat family; one repeat unit is 2gom A:105-165 found in domain
  6. 2696946Protein Fibrinogen-binding protein Efb (Fib) [158368] (1 species)
  7. 2696947Species Staphylococcus aureus [TaxId:1280] [158369] (4 PDB entries)
    Uniprot A6QG59 101-165! Uniprot P68798 105-165! Uniprot P68799 101-165
  8. 2696949Domain d2gomb_: 2gom B: [147150]
    automated match to d2goxb1

Details for d2gomb_

PDB Entry: 2gom (more details), 1.25 Å

PDB Description: Crystal structure of Efb-C from Staphylococcus aureus
PDB Compounds: (B:) Fibrinogen-binding protein

SCOPe Domain Sequences for d2gomb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gomb_ a.7.17.1 (B:) Fibrinogen-binding protein Efb (Fib) {Staphylococcus aureus [TaxId: 1280]}
kkeqkliqaqnlvrefekthtvsahrkaqkavnlvsfeykvkkmvlqeridnvlkqglvr

SCOPe Domain Coordinates for d2gomb_:

Click to download the PDB-style file with coordinates for d2gomb_.
(The format of our PDB-style files is described here.)

Timeline for d2gomb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2goma1