| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.17: Efb C-domain-like [158366] (1 family) ![]() automatically mapped to Pfam PF12199 |
| Family a.7.17.1: Efb C-domain-like [158367] (2 proteins) PfamB PB008033 this is a repeat family; one repeat unit is 2gom A:105-165 found in domain |
| Protein Fibrinogen-binding protein Efb (Fib) [158368] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [158369] (4 PDB entries) Uniprot A6QG59 101-165! Uniprot P68798 105-165! Uniprot P68799 101-165 |
| Domain d2gomb_: 2gom B: [147150] automated match to d2goxb1 |
PDB Entry: 2gom (more details), 1.25 Å
SCOPe Domain Sequences for d2gomb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gomb_ a.7.17.1 (B:) Fibrinogen-binding protein Efb (Fib) {Staphylococcus aureus [TaxId: 1280]}
kkeqkliqaqnlvrefekthtvsahrkaqkavnlvsfeykvkkmvlqeridnvlkqglvr
Timeline for d2gomb_: