SCOPe 2.01: Domain d2gokb2: 2gok B:80-380

Lineage for d2gokb2 (2gok B:80-380)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.17: Imidazolonepropionase-like [159400] (3 proteins)

6. Protein Imidazolonepropionase [159405] (2 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [159407] (2 PDB entries)
   Uniprot Q8U8Z6 78-378

8. Domain d2gokb2: 2gok B:80-380 [147148]
   Other proteins in same PDB: d2goka1, d2gokb1
   automatically matched to 2GOK A:80-380
   complexed with cl, fe, gol, mg

Details for d2gokb2

PDB Entry: 2gok, 1.87 Å

PDB Description: crystal structure of the imidazolonepropionase from agrobacterium tumefaciens at 1.87 a resolution

PDB Compounds: (B:) Imidazolonepropionase

SCOPe Domain Sequences for d2gokb2:

Sequence; same for both SEQRES and ATOM records:

>d2gokb2 c.1.9.17 (B:80-380) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]}
palidchthlvfggnramefemrlngatyeeiakagggivssvrdtralsdevlvaqalp
rldtllsegvstieiksgygldietelkmlrvarrletlrpvrivtsylaahatpadykg
rnadyitdvvlpglekahaegladavdgfcegiafsvkeidrvfaaaqqrglpvklhaeq
lsnlggaelaasynalsadhleyldetgakalakagtvavllpgafyalrekqlppvqal
rdagaeialatdcnpgtspltsllltmnmgatlfrmtveecltattrnaakalgllaetg
t

Timeline for d2gokb2:

• d2gokb2 first appeared in SCOP 1.75
  
• d2gokb2 appears in SCOPe 2.02
  
• d2gokb2 appears in the current release, SCOPe 2.08