Lineage for d2gokb2 (2gok B:80-380)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 971605Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 972077Family c.1.9.17: Imidazolonepropionase-like [159400] (3 proteins)
  6. 972078Protein Imidazolonepropionase [159405] (2 species)
  7. 972079Species Agrobacterium tumefaciens [TaxId:358] [159407] (2 PDB entries)
    Uniprot Q8U8Z6 78-378
  8. 972083Domain d2gokb2: 2gok B:80-380 [147148]
    Other proteins in same PDB: d2goka1, d2gokb1
    automatically matched to 2GOK A:80-380
    complexed with cl, fe, gol, mg

Details for d2gokb2

PDB Entry: 2gok (more details), 1.87 Å

PDB Description: crystal structure of the imidazolonepropionase from agrobacterium tumefaciens at 1.87 a resolution
PDB Compounds: (B:) Imidazolonepropionase

SCOPe Domain Sequences for d2gokb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gokb2 c.1.9.17 (B:80-380) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]}
palidchthlvfggnramefemrlngatyeeiakagggivssvrdtralsdevlvaqalp
rldtllsegvstieiksgygldietelkmlrvarrletlrpvrivtsylaahatpadykg
rnadyitdvvlpglekahaegladavdgfcegiafsvkeidrvfaaaqqrglpvklhaeq
lsnlggaelaasynalsadhleyldetgakalakagtvavllpgafyalrekqlppvqal
rdagaeialatdcnpgtspltsllltmnmgatlfrmtveecltattrnaakalgllaetg
t

SCOPe Domain Coordinates for d2gokb2:

Click to download the PDB-style file with coordinates for d2gokb2.
(The format of our PDB-style files is described here.)

Timeline for d2gokb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gokb1