Class b: All beta proteins [48724] (177 folds) |
Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) this domain is interrupted by the catalytic beta/alpha barrel domain |
Family b.92.1.10: Imidazolonepropionase-like [159347] (3 proteins) |
Protein Imidazolonepropionase [159348] (2 species) |
Species Agrobacterium tumefaciens [TaxId:358] [159350] (2 PDB entries) Uniprot Q8U8Z6 15-77,379-418 |
Domain d2gokb1: 2gok B:17-79,B:381-420 [147147] Other proteins in same PDB: d2goka2, d2gokb2 automated match to d2goka1 complexed with cl, fe, gol, mg |
PDB Entry: 2gok (more details), 1.87 Å
SCOPe Domain Sequences for d2gokb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gokb1 b.92.1.10 (B:17-79,B:381-420) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]} atalwrnaqlatlnpamdgigavenaviavrngriafagpesdlpddlstadettdcggr witXleagksadfaiwdierpaelvyrigfnplharifkgqkvs
Timeline for d2gokb1: