SCOPe 2.06: Domain d2gokb1: 2gok B:17-79,B:381-420

Lineage for d2gokb1 (2gok B:17-79,B:381-420)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.10: Imidazolonepropionase-like [159347] (3 proteins)

6. Protein Imidazolonepropionase [159348] (2 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [159350] (2 PDB entries)
   Uniprot Q8U8Z6 15-77,379-418

8. Domain d2gokb1: 2gok B:17-79,B:381-420 [147147]
   Other proteins in same PDB: d2goka2, d2gokb2
   automated match to d2goka1
   complexed with cl, fe, gol, mg

Details for d2gokb1

PDB Entry: 2gok, 1.87 Å

PDB Description: crystal structure of the imidazolonepropionase from agrobacterium tumefaciens at 1.87 a resolution

PDB Compounds: (B:) Imidazolonepropionase

SCOPe Domain Sequences for d2gokb1:

Sequence; same for both SEQRES and ATOM records:

>d2gokb1 b.92.1.10 (B:17-79,B:381-420) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]}
atalwrnaqlatlnpamdgigavenaviavrngriafagpesdlpddlstadettdcggr
witXleagksadfaiwdierpaelvyrigfnplharifkgqkvs

Timeline for d2gokb1:

• d2gokb1 first appeared in SCOP 1.75
  
• d2gokb1 appears in SCOPe 2.05
  
• d2gokb1 appears in SCOPe 2.07
  
• d2gokb1 appears in the current release, SCOPe 2.08