![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.17: Imidazolonepropionase-like [159400] (3 proteins) automatically mapped to Pfam PF13147 |
![]() | Protein Imidazolonepropionase [159405] (2 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [159407] (2 PDB entries) Uniprot Q8U8Z6 78-378 |
![]() | Domain d2goka2: 2gok A:80-380 [147146] Other proteins in same PDB: d2goka1, d2gokb1 complexed with cl, fe, gol, mg |
PDB Entry: 2gok (more details), 1.87 Å
SCOPe Domain Sequences for d2goka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2goka2 c.1.9.17 (A:80-380) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]} palidchthlvfggnramefemrlngatyeeiakagggivssvrdtralsdevlvaqalp rldtllsegvstieiksgygldietelkmlrvarrletlrpvrivtsylaahatpadykg rnadyitdvvlpglekahaegladavdgfcegiafsvkeidrvfaaaqqrglpvklhaeq lsnlggaelaasynalsadhleyldetgakalakagtvavllpgafyalrekqlppvqal rdagaeialatdcnpgtspltsllltmnmgatlfrmtveecltattrnaakalgllaetg t
Timeline for d2goka2: