Lineage for d2goka1 (2gok A:17-79,A:381-420)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 965039Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 965040Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 965258Family b.92.1.10: Imidazolonepropionase-like [159347] (3 proteins)
  6. 965259Protein Imidazolonepropionase [159348] (2 species)
  7. 965260Species Agrobacterium tumefaciens [TaxId:358] [159350] (2 PDB entries)
    Uniprot Q8U8Z6 15-77,379-418
  8. 965263Domain d2goka1: 2gok A:17-79,A:381-420 [147145]
    Other proteins in same PDB: d2goka2, d2gokb2
    complexed with cl, fe, gol, mg

Details for d2goka1

PDB Entry: 2gok (more details), 1.87 Å

PDB Description: crystal structure of the imidazolonepropionase from agrobacterium tumefaciens at 1.87 a resolution
PDB Compounds: (A:) Imidazolonepropionase

SCOPe Domain Sequences for d2goka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2goka1 b.92.1.10 (A:17-79,A:381-420) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]}
atalwrnaqlatlnpamdgigavenaviavrngriafagpesdlpddlstadettdcggr
witXleagksadfaiwdierpaelvyrigfnplharifkgqkvs

SCOPe Domain Coordinates for d2goka1:

Click to download the PDB-style file with coordinates for d2goka1.
(The format of our PDB-style files is described here.)

Timeline for d2goka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2goka2