SCOP 1.75: Domain d2goka1: 2gok A:17-79,A:381-420

Lineage for d2goka1 (2gok A:17-79,A:381-420)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (11 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.10: Imidazolonepropionase-like [159347] (3 proteins)

6. Protein Imidazolonepropionase [159348] (2 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [159350] (2 PDB entries)
   Uniprot Q8U8Z6 15-77,379-418

8. Domain d2goka1: 2gok A:17-79,A:381-420 [147145]
   Other proteins in same PDB: d2goka2, d2gokb2
   complexed with cl, fe, gol, mg

Details for d2goka1

PDB Entry: 2gok, 1.87 Å

PDB Description: crystal structure of the imidazolonepropionase from agrobacterium tumefaciens at 1.87 a resolution

PDB Compounds: (A:) Imidazolonepropionase

SCOP Domain Sequences for d2goka1:

Sequence; same for both SEQRES and ATOM records:

>d2goka1 b.92.1.10 (A:17-79,A:381-420) Imidazolonepropionase {Agrobacterium tumefaciens [TaxId: 358]}
atalwrnaqlatlnpamdgigavenaviavrngriafagpesdlpddlstadettdcggr
witXleagksadfaiwdierpaelvyrigfnplharifkgqkvs

Timeline for d2goka1:

• d2goka1 is new in SCOP 1.75
  
• d2goka1 appears in SCOPe 2.01
  
• d2goka1 appears in the current release, SCOPe 2.08