![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (23 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.5: PG130-like [102959] (5 proteins) subfamily of Pfam PF03992 |
![]() | Protein Hypothetical protein YqjZ [160283] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [160284] (1 PDB entry) Uniprot P54563 3-110 |
![]() | Domain d2go8a1: 2go8 A:3-110 [147144] |
PDB Entry: 2go8 (more details), 2.3 Å
SCOP Domain Sequences for d2go8a1:
Sequence, based on SEQRES records: (download)
>d2go8a1 d.58.4.5 (A:3-110) Hypothetical protein YqjZ {Bacillus subtilis [TaxId: 1423]} dflsktpeppyyavifssvksendtgygetaermvslaadqpgflgvesvreadgrgitv sywdsmdainhwrhhtehqaakekgrsvwyesyavrvakvdrqrlfqe
>d2go8a1 d.58.4.5 (A:3-110) Hypothetical protein YqjZ {Bacillus subtilis [TaxId: 1423]} dflsktpeppyyavifssvksgetaermvslaadqpgflgvesvreadgrgitvsywdsm dainhwrhhtyesyavrvakvdrqrlfqe
Timeline for d2go8a1: