Lineage for d2gnxa2 (2gnx A:295-440)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210161Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2210467Superfamily d.109.3: FLJ32549 C-terminal domain-like [160651] (1 family) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; similar to the Roadblock/LC7 domain
  5. 2210468Family d.109.3.1: FLJ32549 C-terminal domain-like [160652] (1 protein)
    C-terminal part of Pfam PF09404; DUF2003
  6. 2210469Protein Hypothetical protein BC048403 [160653] (1 species)
    FLJ32549 ortholog
  7. 2210470Species Mouse (Mus musculus) [TaxId:10090] [160654] (1 PDB entry)
    Uniprot Q6P1I3 295-440
  8. 2210471Domain d2gnxa2: 2gnx A:295-440 [147143]
    Other proteins in same PDB: d2gnxa1

Details for d2gnxa2

PDB Entry: 2gnx (more details), 2.45 Å

PDB Description: x-ray structure of a hypothetical protein from mouse mm.209172
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2gnxa2:

Sequence, based on SEQRES records: (download)

>d2gnxa2 d.109.3.1 (A:295-440) Hypothetical protein BC048403 {Mouse (Mus musculus) [TaxId: 10090]}
pdlfgkissfirkydaanvslifdnrgsesfqghgyhhphsyreapkgvdqypavvslps
drpvmhwpnvimimtdrasdlnslekvvhfyddkvqstyfltrpephftivvifeskkse
rdshfisflnelslalknpkvfaslk

Sequence, based on observed residues (ATOM records): (download)

>d2gnxa2 d.109.3.1 (A:295-440) Hypothetical protein BC048403 {Mouse (Mus musculus) [TaxId: 10090]}
pdlfgkissfirkydaanvslifdqypavvslpsdrpvmhwpnvimimtdrasdlnslek
vvhfyddkvqstyfltrpephftivvifeskkserdshfisflnelslalknpkvfaslk

SCOPe Domain Coordinates for d2gnxa2:

Click to download the PDB-style file with coordinates for d2gnxa2.
(The format of our PDB-style files is described here.)

Timeline for d2gnxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gnxa1