Lineage for d2gnxa1 (2gnx A:123-294)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351179Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 2351246Superfamily a.246.3: FLJ32549 domain-like [158548] (1 family) (S)
  5. 2351247Family a.246.3.1: FLJ32549 domain-like [158549] (1 protein)
    middle part of Pfam PF09404; DUF2003
  6. 2351248Protein Hypothetical protein BC048403 [158550] (1 species)
    FLJ32549 ortholog; cDNA sequence
  7. 2351249Species Mouse (Mus musculus) [TaxId:10090] [158551] (1 PDB entry)
    Uniprot Q6P1I3 123-294
  8. 2351250Domain d2gnxa1: 2gnx A:123-294 [147142]
    Other proteins in same PDB: d2gnxa2

Details for d2gnxa1

PDB Entry: 2gnx (more details), 2.45 Å

PDB Description: x-ray structure of a hypothetical protein from mouse mm.209172
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2gnxa1:

Sequence, based on SEQRES records: (download)

>d2gnxa1 a.246.3.1 (A:123-294) Hypothetical protein BC048403 {Mouse (Mus musculus) [TaxId: 10090]}
phlseqlcffvqarmeiadfyekmyalstqkfinteelvstldtilrkyssrfhhpilsp
lessfqlevgvlshllkaqaqisewkflpslvtlhnahtklqswgqtfekqretkkhlfg
gqsqkavqpphlflwlmklktmllakfsfyfhealsrqttasemkaltakan

Sequence, based on observed residues (ATOM records): (download)

>d2gnxa1 a.246.3.1 (A:123-294) Hypothetical protein BC048403 {Mouse (Mus musculus) [TaxId: 10090]}
phlseqlcffvqarmeiadfyekmyalstqkfinteelvstldtilrkysplessfqlev
gvlshllkaqaqisewkflpslvtlhnahtklqswgqtfekqrpphlflwlmklktmlla
kfsfyfhealsrqttasemkaltakan

SCOPe Domain Coordinates for d2gnxa1:

Click to download the PDB-style file with coordinates for d2gnxa1.
(The format of our PDB-style files is described here.)

Timeline for d2gnxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gnxa2