SCOPe 2.05: Domain d2gnxa1: 2gnx A:123-294

Lineage for d2gnxa1 (2gnx A:123-294)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
   5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology

4. Superfamily a.246.3: FLJ32549 domain-like [158548] (1 family)

5. Family a.246.3.1: FLJ32549 domain-like [158549] (1 protein)
   middle part of Pfam PF09404; DUF2003

6. Protein Hypothetical protein BC048403 [158550] (1 species)
   FLJ32549 ortholog; cDNA sequence

7. Species Mouse (Mus musculus) [TaxId:10090] [158551] (1 PDB entry)
   Uniprot Q6P1I3 123-294

8. Domain d2gnxa1: 2gnx A:123-294 [147142]
   Other proteins in same PDB: d2gnxa2

Details for d2gnxa1

PDB Entry: 2gnx, 2.45 Å

PDB Description: x-ray structure of a hypothetical protein from mouse mm.209172

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2gnxa1:

Sequence, based on SEQRES records:

>d2gnxa1 a.246.3.1 (A:123-294) Hypothetical protein BC048403 {Mouse (Mus musculus) [TaxId: 10090]}
phlseqlcffvqarmeiadfyekmyalstqkfinteelvstldtilrkyssrfhhpilsp
lessfqlevgvlshllkaqaqisewkflpslvtlhnahtklqswgqtfekqretkkhlfg
gqsqkavqpphlflwlmklktmllakfsfyfhealsrqttasemkaltakan

Sequence, based on observed residues (ATOM records):

>d2gnxa1 a.246.3.1 (A:123-294) Hypothetical protein BC048403 {Mouse (Mus musculus) [TaxId: 10090]}
phlseqlcffvqarmeiadfyekmyalstqkfinteelvstldtilrkysplessfqlev
gvlshllkaqaqisewkflpslvtlhnahtklqswgqtfekqrpphlflwlmklktmlla
kfsfyfhealsrqttasemkaltakan

Timeline for d2gnxa1:

• d2gnxa1 first appeared in SCOP 1.75
  
• d2gnxa1 appears in SCOPe 2.04
  
• d2gnxa1 appears in SCOPe 2.06
  
• d2gnxa1 appears in the current release, SCOPe 2.08