SCOPe 2.08: Domain d2gmwb_: 2gmw B:

Lineage for d2gmwb_ (2gmw B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.19: Histidinol phosphatase-like [142177] (3 proteins)
   no insertion subdomains

6. Protein D,D-heptose 1,7-bisphosphate phosphatase GmhB [159534] (1 species)

7. Species Escherichia coli [TaxId:562] [159535] (8 PDB entries)
   Uniprot P63228 4-185

8. Domain d2gmwb_: 2gmw B: [147138]
   automated match to d2gmwa1
   complexed with zn

Details for d2gmwb_

PDB Entry: 2gmw, 1.5 Å

PDB Description: crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from e. coli.

PDB Compounds: (B:) D,D-heptose 1,7-bisphosphate phosphatase

SCOPe Domain Sequences for d2gmwb_:

Sequence; same for both SEQRES and ATOM records:

>d2gmwb_ c.108.1.19 (B:) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]}
svpaifldrdgtinvdhgyvheidnfefidgvidamrelkkmgfalvvvtnqsgiargkf
teaqfetltewmdwsladrdvdldgiyycphhpqgsveefrqvcdcrkphpgmllsardy
lhidmaasymvgdkledmqaavaanvgtkvlvrtgkpitpeaenaadwvlnsladlpqai
kkqq

Timeline for d2gmwb_:

• d2gmwb_ first appeared in SCOP 1.75, called d2gmwb1
  
• d2gmwb_ appears in SCOPe 2.07