Lineage for d2gmwa1 (2gmw A:24-205)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920176Family c.108.1.19: Histidinol phosphatase-like [142177] (3 proteins)
    no insertion subdomains
  6. 2920177Protein D,D-heptose 1,7-bisphosphate phosphatase GmhB [159534] (1 species)
  7. 2920178Species Escherichia coli [TaxId:562] [159535] (8 PDB entries)
    Uniprot P63228 4-185
  8. 2920180Domain d2gmwa1: 2gmw A:24-205 [147137]
    complexed with zn

Details for d2gmwa1

PDB Entry: 2gmw (more details), 1.5 Å

PDB Description: crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from e. coli.
PDB Compounds: (A:) D,D-heptose 1,7-bisphosphate phosphatase

SCOPe Domain Sequences for d2gmwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]}
svpaifldrdgtinvdhgyvheidnfefidgvidamrelkkmgfalvvvtnqsgiargkf
teaqfetltewmdwsladrdvdldgiyycphhpqgsveefrqvcdcrkphpgmllsardy
lhidmaasymvgdkledmqaavaanvgtkvlvrtgkpitpeaenaadwvlnsladlpqai
kk

SCOPe Domain Coordinates for d2gmwa1:

Click to download the PDB-style file with coordinates for d2gmwa1.
(The format of our PDB-style files is described here.)

Timeline for d2gmwa1: