![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (14 families) ![]() |
![]() | Family b.122.1.11: PrgU-like [159365] (2 proteins) Pfam PF09627 |
![]() | Protein automated matches [190662] (1 species) not a true protein |
![]() | Species Enterococcus faecalis [TaxId:1351] [187758] (1 PDB entry) |
![]() | Domain d2gmqb_: 2gmq B: [147136] Other proteins in same PDB: d2gmqa1 automated match to d2gmqa1 |
PDB Entry: 2gmq (more details), 1.76 Å
SCOPe Domain Sequences for d2gmqb_:
Sequence, based on SEQRES records: (download)
>d2gmqb_ b.122.1.11 (B:) automated matches {Enterococcus faecalis [TaxId: 1351]} mkeiaiqekdltlqwrgntgklvkvrlkntramemwynkqiteeniqeittlniikngks lalevypeksiyvkpnlgrinvpvffiktpinrgvfeeifg
>d2gmqb_ b.122.1.11 (B:) automated matches {Enterococcus faecalis [TaxId: 1351]} mkeiaiqekdltlqwrgntgklvkvrlkntramemwynkqiteeniqeittlniikngks lalevypeksiyvkpgrinvpvffiktpinrgvfeeifg
Timeline for d2gmqb_: