SCOPe 2.07: Domain d2gmqb_: 2gmq B:

Lineage for d2gmqb_ (2gmq B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.11: PrgU-like [159365] (2 proteins)
   Pfam PF09627

6. Protein automated matches [190662] (1 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [187758] (1 PDB entry)

8. Domain d2gmqb_: 2gmq B: [147136]
   Other proteins in same PDB: d2gmqa1
   automated match to d2gmqa1

Details for d2gmqb_

PDB Entry: 2gmq, 1.76 Å

PDB Description: Crystal structure of protein EF0006 from Enterococcus faecalis

PDB Compounds: (B:) Hypothetical protein EF0006

SCOPe Domain Sequences for d2gmqb_:

Sequence, based on SEQRES records:

>d2gmqb_ b.122.1.11 (B:) automated matches {Enterococcus faecalis [TaxId: 1351]}
mkeiaiqekdltlqwrgntgklvkvrlkntramemwynkqiteeniqeittlniikngks
lalevypeksiyvkpnlgrinvpvffiktpinrgvfeeifg

Sequence, based on observed residues (ATOM records):

>d2gmqb_ b.122.1.11 (B:) automated matches {Enterococcus faecalis [TaxId: 1351]}
mkeiaiqekdltlqwrgntgklvkvrlkntramemwynkqiteeniqeittlniikngks
lalevypeksiyvkpgrinvpvffiktpinrgvfeeifg

Timeline for d2gmqb_:

• d2gmqb_ first appeared in SCOP 1.75, called d2gmqb1
  
• d2gmqb_ appears in SCOPe 2.06
  
• d2gmqb_ appears in the current release, SCOPe 2.08