Lineage for d2gmqb1 (2gmq B:13-113)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813146Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 813147Superfamily b.122.1: PUA domain-like [88697] (13 families) (S)
  5. 813332Family b.122.1.11: PrgU-like [159365] (1 protein)
    Pfam PF09627
  6. 813333Protein Uncharacterized protein PrgU [159366] (1 species)
  7. 813334Species Enterococcus faecalis [TaxId:1351] [159367] (1 PDB entry)
    Uniprot Q8KUD5 12-113
    EF0006
  8. 813336Domain d2gmqb1: 2gmq B:13-113 [147136]
    automatically matched to 2GMQ A:12-113

Details for d2gmqb1

PDB Entry: 2gmq (more details), 1.76 Å

PDB Description: Crystal structure of protein EF0006 from Enterococcus faecalis
PDB Compounds: (B:) Hypothetical protein EF0006

SCOP Domain Sequences for d2gmqb1:

Sequence, based on SEQRES records: (download)

>d2gmqb1 b.122.1.11 (B:13-113) Uncharacterized protein PrgU {Enterococcus faecalis [TaxId: 1351]}
mkeiaiqekdltlqwrgntgklvkvrlkntramemwynkqiteeniqeittlniikngks
lalevypeksiyvkpnlgrinvpvffiktpinrgvfeeifg

Sequence, based on observed residues (ATOM records): (download)

>d2gmqb1 b.122.1.11 (B:13-113) Uncharacterized protein PrgU {Enterococcus faecalis [TaxId: 1351]}
mkeiaiqekdltlqwrgntgklvkvrlkntramemwynkqiteeniqeittlniikngks
lalevypeksiyvkpgrinvpvffiktpinrgvfeeifg

SCOP Domain Coordinates for d2gmqb1:

Click to download the PDB-style file with coordinates for d2gmqb1.
(The format of our PDB-style files is described here.)

Timeline for d2gmqb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gmqa1