Lineage for d2gmqb_ (2gmq B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2823864Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2823865Superfamily b.122.1: PUA domain-like [88697] (15 families) (S)
  5. 2824065Family b.122.1.11: PrgU-like [159365] (2 proteins)
    Pfam PF09627
  6. 2824069Protein automated matches [190662] (1 species)
    not a true protein
  7. 2824070Species Enterococcus faecalis [TaxId:1351] [187758] (1 PDB entry)
  8. 2824071Domain d2gmqb_: 2gmq B: [147136]
    Other proteins in same PDB: d2gmqa1
    automated match to d2gmqa1

Details for d2gmqb_

PDB Entry: 2gmq (more details), 1.76 Å

PDB Description: Crystal structure of protein EF0006 from Enterococcus faecalis
PDB Compounds: (B:) Hypothetical protein EF0006

SCOPe Domain Sequences for d2gmqb_:

Sequence, based on SEQRES records: (download)

>d2gmqb_ b.122.1.11 (B:) automated matches {Enterococcus faecalis [TaxId: 1351]}
mkeiaiqekdltlqwrgntgklvkvrlkntramemwynkqiteeniqeittlniikngks
lalevypeksiyvkpnlgrinvpvffiktpinrgvfeeifg

Sequence, based on observed residues (ATOM records): (download)

>d2gmqb_ b.122.1.11 (B:) automated matches {Enterococcus faecalis [TaxId: 1351]}
mkeiaiqekdltlqwrgntgklvkvrlkntramemwynkqiteeniqeittlniikngks
lalevypeksiyvkpgrinvpvffiktpinrgvfeeifg

SCOPe Domain Coordinates for d2gmqb_:

Click to download the PDB-style file with coordinates for d2gmqb_.
(The format of our PDB-style files is described here.)

Timeline for d2gmqb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gmqa1