Lineage for d2gmqa1 (2gmq A:12-113)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2432833Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2432834Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2433035Family b.122.1.11: PrgU-like [159365] (2 proteins)
    Pfam PF09627
  6. 2433036Protein Uncharacterized protein PrgU [159366] (1 species)
  7. 2433037Species Enterococcus faecalis [TaxId:1351] [159367] (1 PDB entry)
    Uniprot Q8KUD5 12-113
    EF0006
  8. 2433038Domain d2gmqa1: 2gmq A:12-113 [147135]
    Other proteins in same PDB: d2gmqb_

Details for d2gmqa1

PDB Entry: 2gmq (more details), 1.76 Å

PDB Description: Crystal structure of protein EF0006 from Enterococcus faecalis
PDB Compounds: (A:) Hypothetical protein EF0006

SCOPe Domain Sequences for d2gmqa1:

Sequence, based on SEQRES records: (download)

>d2gmqa1 b.122.1.11 (A:12-113) Uncharacterized protein PrgU {Enterococcus faecalis [TaxId: 1351]}
gmkeiaiqekdltlqwrgntgklvkvrlkntramemwynkqiteeniqeittlniikngk
slalevypeksiyvkpnlgrinvpvffiktpinrgvfeeifg

Sequence, based on observed residues (ATOM records): (download)

>d2gmqa1 b.122.1.11 (A:12-113) Uncharacterized protein PrgU {Enterococcus faecalis [TaxId: 1351]}
gmkeiaiqekdltlqwrgntgklvkvrlkntramemwynkqiteeniqeittlniikngk
slalevypeksiyvkprinvpvffiktpinrgvfeeifg

SCOPe Domain Coordinates for d2gmqa1:

Click to download the PDB-style file with coordinates for d2gmqa1.
(The format of our PDB-style files is described here.)

Timeline for d2gmqa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gmqb_