SCOPe 2.05: Domain d2gmqa1: 2gmq A:12-113

Lineage for d2gmqa1 (2gmq A:12-113)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.11: PrgU-like [159365] (2 proteins)
   Pfam PF09627

6. Protein Uncharacterized protein PrgU [159366] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [159367] (1 PDB entry)
   Uniprot Q8KUD5 12-113
   EF0006

8. Domain d2gmqa1: 2gmq A:12-113 [147135]
   Other proteins in same PDB: d2gmqb_

Details for d2gmqa1

PDB Entry: 2gmq, 1.76 Å

PDB Description: Crystal structure of protein EF0006 from Enterococcus faecalis

PDB Compounds: (A:) Hypothetical protein EF0006

SCOPe Domain Sequences for d2gmqa1:

Sequence, based on SEQRES records:

>d2gmqa1 b.122.1.11 (A:12-113) Uncharacterized protein PrgU {Enterococcus faecalis [TaxId: 1351]}
gmkeiaiqekdltlqwrgntgklvkvrlkntramemwynkqiteeniqeittlniikngk
slalevypeksiyvkpnlgrinvpvffiktpinrgvfeeifg

Sequence, based on observed residues (ATOM records):

>d2gmqa1 b.122.1.11 (A:12-113) Uncharacterized protein PrgU {Enterococcus faecalis [TaxId: 1351]}
gmkeiaiqekdltlqwrgntgklvkvrlkntramemwynkqiteeniqeittlniikngk
slalevypeksiyvkprinvpvffiktpinrgvfeeifg

Timeline for d2gmqa1:

• d2gmqa1 first appeared in SCOP 1.75
  
• d2gmqa1 appears in SCOPe 2.04
  
• d2gmqa1 appears in SCOPe 2.06
  
• d2gmqa1 appears in the current release, SCOPe 2.08