Lineage for d2gmnb_ (2gmn B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603534Species Bradyrhizobium japonicum [TaxId:224911] [187297] (1 PDB entry)
  8. 2603535Domain d2gmnb_: 2gmn B: [147133]
    Other proteins in same PDB: d2gmna1
    automated match to d1jt1a_
    complexed with zn

Details for d2gmnb_

PDB Entry: 2gmn (more details), 1.4 Å

PDB Description: crystal structure of bjp-1, a subclass b3 metallo-beta-lactamase of bradyrhizobium japonicum
PDB Compounds: (B:) metallo-beta-lactamase

SCOPe Domain Sequences for d2gmnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmnb_ d.157.1.0 (B:) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
vamkkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmikdniaklg
fkvadiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgdeknedlafp
avkvdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlffcsgtvaln
rlvgqptyagivddyratfakakamkidvllgphpevygmqakraemkdgapnpfikpge
lvtyatslsedfdkqlakqtaale

SCOPe Domain Coordinates for d2gmnb_:

Click to download the PDB-style file with coordinates for d2gmnb_.
(The format of our PDB-style files is described here.)

Timeline for d2gmnb_: