Lineage for d2gmnb1 (2gmn B:29-292)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 876590Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 876591Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (14 families) (S)
  5. 876592Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)
  6. 876593Protein Zn metallo-beta-lactamase [56283] (10 species)
  7. 876629Species Bradyrhizobium japonicum [TaxId:375] [160849] (1 PDB entry)
    Uniprot Q89GW5 29-292
  8. 876631Domain d2gmnb1: 2gmn B:29-292 [147133]
    automatically matched to 2GMN A:29-292
    complexed with zn

Details for d2gmnb1

PDB Entry: 2gmn (more details), 1.4 Å

PDB Description: crystal structure of bjp-1, a subclass b3 metallo-beta-lactamase of bradyrhizobium japonicum
PDB Compounds: (B:) metallo-beta-lactamase

SCOP Domain Sequences for d2gmnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmnb1 d.157.1.1 (B:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]}
vamkkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmikdniaklg
fkvadiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgdeknedlafp
avkvdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlffcsgtvaln
rlvgqptyagivddyratfakakamkidvllgphpevygmqakraemkdgapnpfikpge
lvtyatslsedfdkqlakqtaale

SCOP Domain Coordinates for d2gmnb1:

Click to download the PDB-style file with coordinates for d2gmnb1.
(The format of our PDB-style files is described here.)

Timeline for d2gmnb1: