Lineage for d2gmna1 (2gmn A:29-292)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1224490Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1224491Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1224492Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1224493Protein Zn metallo-beta-lactamase [56283] (11 species)
  7. 1224549Species Bradyrhizobium japonicum [TaxId:375] [160849] (1 PDB entry)
    Uniprot Q89GW5 29-292
  8. 1224550Domain d2gmna1: 2gmn A:29-292 [147132]
    Other proteins in same PDB: d2gmnb_
    complexed with zn

Details for d2gmna1

PDB Entry: 2gmn (more details), 1.4 Å

PDB Description: crystal structure of bjp-1, a subclass b3 metallo-beta-lactamase of bradyrhizobium japonicum
PDB Compounds: (A:) metallo-beta-lactamase

SCOPe Domain Sequences for d2gmna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]}
vamkkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmikdniaklg
fkvadiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgdeknedlafp
avkvdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlffcsgtvaln
rlvgqptyagivddyratfakakamkidvllgphpevygmqakraemkdgapnpfikpge
lvtyatslsedfdkqlakqtaale

SCOPe Domain Coordinates for d2gmna1:

Click to download the PDB-style file with coordinates for d2gmna1.
(The format of our PDB-style files is described here.)

Timeline for d2gmna1: