SCOP 1.75: Domain d2gmga1: 2gmg A:1-105

Lineage for d2gmga1 (2gmg A:1-105)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.82: PF0610-like [158332] (1 protein)
   PfamB PB016993; insertion of a zinc-ribbon subdomain in the beta-hairpin "wing"

6. Protein Hypothetical protein PF0610 [158333] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [158334] (1 PDB entry)
   Uniprot Q8U362 1-105

8. Domain d2gmga1: 2gmg A:1-105 [147131]

Details for d2gmga1

PDB Entry: 2gmg

PDB Description: Solution NMR Structure of protein PF0610 from Pyrococcus furiosus, Northeast Structural Genomics Consortium Target PfG3

PDB Compounds: (A:) hypothetical protein Pf0610

SCOP Domain Sequences for d2gmga1:

Sequence; same for both SEQRES and ATOM records:

>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]}
ahhhhhhgsatrrekiielllegdyspselarildmrgkgskkviledlkviskiakreg
mvllikpaqcrkcgfvfkaeinipsrcpkcksewieeprfklerk

Timeline for d2gmga1:

• d2gmga1 is new in SCOP 1.75
  
• d2gmga1 appears in SCOPe 2.01
  
• d2gmga1 appears in the current release, SCOPe 2.08