![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.82: PF0610-like [158332] (1 protein) PfamB PB016993; insertion of a zinc-ribbon subdomain in the beta-hairpin "wing" |
![]() | Protein Hypothetical protein PF0610 [158333] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [158334] (1 PDB entry) Uniprot Q8U362 1-105 |
![]() | Domain d2gmga1: 2gmg A:10-105 [147131] Other proteins in same PDB: d2gmga2 |
PDB Entry: 2gmg (more details)
SCOPe Domain Sequences for d2gmga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gmga1 a.4.5.82 (A:10-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} atrrekiielllegdyspselarildmrgkgskkviledlkviskiakregmvllikpaq crkcgfvfkaeinipsrcpkcksewieeprfklerk
Timeline for d2gmga1: