SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2gk3d_ (2gk3 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2104318Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2104729Family c.23.16.9: STM3548-like [159492] (2 protein domains)
    Pfam PF07090; DUF1355
  6. 2104730Protein Putative cytoplasmic protein STM3548 [159493] (1 species)
  7. 2104731Species Salmonella typhimurium [TaxId:90371] [159494] (1 PDB entry)
    Uniprot Q8ZLF9 8-253
  8. 2104735Domain d2gk3d_: 2gk3 D: [147126]
    automated match to d2gk3a1
    complexed with gol

Details for d2gk3d_

PDB Entry: 2gk3 (more details), 2.25 Å

PDB Description: Cytoplasmic Protein STM3548 from Salmonella typhimurium
PDB Compounds: (D:) putative cytoplasmic protein

SCOPe Domain Sequences for d2gk3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gk3d_ c.23.16.9 (D:) Putative cytoplasmic protein STM3548 {Salmonella typhimurium [TaxId: 90371]}
lkvlfigeswhihmihskgydsftsskyeegatwlleclrkggvdidympahtvqiafpe
sidelnrydvivisdigsntfllqnetfyqlkikpnalesikeyvkngggllmiggylsf
mgieakanykntvlaevlpvimldgddrvekpegicaeavspehpvvngfsdypvflgyn
qavarddadvvltinndpllvfgeyqqgktacfmsdcsphwgtqqfmswpfytdlwvntl
qfiark

SCOPe Domain Coordinates for d2gk3d_:

Click to download the PDB-style file with coordinates for d2gk3d_.
(The format of our PDB-style files is described here.)

Timeline for d2gk3d_: