| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.9: STM3548-like [159492] (2 proteins) Pfam PF07090; DUF1355 |
| Protein Putative cytoplasmic protein STM3548 [159493] (1 species) |
| Species Salmonella typhimurium [TaxId:90371] [159494] (1 PDB entry) Uniprot Q8ZLF9 8-253 |
| Domain d2gk3d_: 2gk3 D: [147126] automated match to d2gk3a1 complexed with gol |
PDB Entry: 2gk3 (more details), 2.25 Å
SCOPe Domain Sequences for d2gk3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gk3d_ c.23.16.9 (D:) Putative cytoplasmic protein STM3548 {Salmonella typhimurium [TaxId: 90371]}
lkvlfigeswhihmihskgydsftsskyeegatwlleclrkggvdidympahtvqiafpe
sidelnrydvivisdigsntfllqnetfyqlkikpnalesikeyvkngggllmiggylsf
mgieakanykntvlaevlpvimldgddrvekpegicaeavspehpvvngfsdypvflgyn
qavarddadvvltinndpllvfgeyqqgktacfmsdcsphwgtqqfmswpfytdlwvntl
qfiark
Timeline for d2gk3d_: