SCOP 1.75: Domain d2gk3c1: 2gk3 C:8-253

Lineage for d2gk3c1 (2gk3 C:8-253)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (9 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.9: STM3548-like [159492] (1 protein)
   Pfam PF07090; DUF1355

6. Protein Putative cytoplasmic protein STM3548 [159493] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [159494] (1 PDB entry)
   Uniprot Q8ZLF9 8-253

8. Domain d2gk3c1: 2gk3 C:8-253 [147125]
   automatically matched to 2GK3 A:8-253
   complexed with gol

Details for d2gk3c1

PDB Entry: 2gk3, 2.25 Å

PDB Description: Cytoplasmic Protein STM3548 from Salmonella typhimurium

PDB Compounds: (C:) putative cytoplasmic protein

SCOP Domain Sequences for d2gk3c1:

Sequence; same for both SEQRES and ATOM records:

>d2gk3c1 c.23.16.9 (C:8-253) Putative cytoplasmic protein STM3548 {Salmonella typhimurium [TaxId: 90371]}
lkvlfigeswhihmihskgydsftsskyeegatwlleclrkggvdidympahtvqiafpe
sidelnrydvivisdigsntfllqnetfyqlkikpnalesikeyvkngggllmiggylsf
mgieakanykntvlaevlpvimldgddrvekpegicaeavspehpvvngfsdypvflgyn
qavarddadvvltinndpllvfgeyqqgktacfmsdcsphwgtqqfmswpfytdlwvntl
qfiark

Timeline for d2gk3c1:

• d2gk3c1 is new in SCOP 1.75
  
• d2gk3c1 is called d2gk3c_ in SCOPe 2.01
  
• d2gk3c1 appears in the current release, SCOPe 2.08, called d2gk3c_