Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.9: STM3548-like [159492] (2 proteins) Pfam PF07090; DUF1355 |
Protein Putative cytoplasmic protein STM3548 [159493] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [159494] (1 PDB entry) Uniprot Q8ZLF9 8-253 |
Domain d2gk3a1: 2gk3 A:8-253 [147123] complexed with gol |
PDB Entry: 2gk3 (more details), 2.25 Å
SCOPe Domain Sequences for d2gk3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gk3a1 c.23.16.9 (A:8-253) Putative cytoplasmic protein STM3548 {Salmonella typhimurium [TaxId: 90371]} lkvlfigeswhihmihskgydsftsskyeegatwlleclrkggvdidympahtvqiafpe sidelnrydvivisdigsntfllqnetfyqlkikpnalesikeyvkngggllmiggylsf mgieakanykntvlaevlpvimldgddrvekpegicaeavspehpvvngfsdypvflgyn qavarddadvvltinndpllvfgeyqqgktacfmsdcsphwgtqqfmswpfytdlwvntl qfiark
Timeline for d2gk3a1: