| Class b: All beta proteins [48724] (174 folds) |
| Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
| Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
| Protein beta-Lactoglobulin [50827] (3 species) |
| Species Cow (Bos taurus) [TaxId:9913] [50828] (31 PDB entries) Uniprot P02754 |
| Domain d2gj5a_: 2gj5 A: [147122] automated match to d1bsqa_ complexed with vd3 |
PDB Entry: 2gj5 (more details), 2.4 Å
SCOPe Domain Sequences for d2gj5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gj5a_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
ivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkw
engecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc
lvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
Timeline for d2gj5a_: