Lineage for d2gj5a_ (2gj5 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957981Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 957982Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 957983Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 958006Protein beta-Lactoglobulin [50827] (3 species)
  7. 958007Species Cow (Bos taurus) [TaxId:9913] [50828] (31 PDB entries)
    Uniprot P02754
  8. 958029Domain d2gj5a_: 2gj5 A: [147122]
    automated match to d1bsqa_
    complexed with vd3

Details for d2gj5a_

PDB Entry: 2gj5 (more details), 2.4 Å

PDB Description: Crystal structure of a secondary vitamin D3 binding site of milk beta-lactoglobulin
PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d2gj5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gj5a_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
ivtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkw
engecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqc
lvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

SCOPe Domain Coordinates for d2gj5a_:

Click to download the PDB-style file with coordinates for d2gj5a_.
(The format of our PDB-style files is described here.)

Timeline for d2gj5a_: