Lineage for d2ginf_ (2gin F:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1565570Fold b.159: AOC barrel-like [141492] (2 superfamilies)
    barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds
  4. 1565571Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families) (S)
  5. 1565572Family b.159.1.1: Allene oxide cyclase-like [141494] (2 proteins)
    Pfam PF06351
  6. 1565573Protein Allene oxide cyclase, AOC [141495] (2 species)
  7. 1565576Species Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId:3702] [141496] (5 PDB entries)
    Uniprot Q9LS02 80-253
  8. 1565592Domain d2ginf_: 2gin F: [147121]
    automated match to d1z8ka1
    complexed with gol, na

Details for d2ginf_

PDB Entry: 2gin (more details), 1.8 Å

PDB Description: X-ray structure of the wt allene oxide cyclase 2 from arabidopsis thaliana
PDB Compounds: (F:) Allene oxide cyclase 2

SCOPe Domain Sequences for d2ginf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ginf_ b.159.1.1 (F:) Allene oxide cyclase, AOC {Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId: 3702]}
vqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvie
hvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqqlv
yptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn

SCOPe Domain Coordinates for d2ginf_:

Click to download the PDB-style file with coordinates for d2ginf_.
(The format of our PDB-style files is described here.)

Timeline for d2ginf_: