![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.159: AOC barrel-like [141492] (2 superfamilies) barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds |
![]() | Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families) ![]() |
![]() | Family b.159.1.1: Allene oxide cyclase-like [141494] (2 proteins) Pfam PF06351 |
![]() | Protein Allene oxide cyclase, AOC [141495] (2 species) |
![]() | Species Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId:3702] [141496] (5 PDB entries) Uniprot Q9LS02 80-253 |
![]() | Domain d2ginb_: 2gin B: [147117] automated match to d1z8ka1 complexed with gol, na |
PDB Entry: 2gin (more details), 1.8 Å
SCOPe Domain Sequences for d2ginb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ginb_ b.159.1.1 (B:) Allene oxide cyclase, AOC {Thale cress (Arabidopsis thaliana), chloroplast AOC2 [TaxId: 3702]} vqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvie hvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqqlv yptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
Timeline for d2ginb_: