SCOPe 2.01: Domain d2geyc1: 2gey C:2-145

Lineage for d2geyc1 (2gey C:2-145)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (6 proteins)

6. Protein Putative hydroxylase AclR [159969] (1 species)

7. Species Streptomyces galilaeus [TaxId:33899] [159970] (1 PDB entry)
   Uniprot Q1XDX7 2-145

8. Domain d2geyc1: 2gey C:2-145 [147115]
   automatically matched to 2GEY A:2-145
   complexed with gol, peg, pg4

Details for d2geyc1

PDB Entry: 2gey, 1.8 Å

PDB Description: Crystal Structure of AclR a putative hydroxylase from Streptomyces galilaeus

PDB Compounds: (C:) AclR protein

SCOPe Domain Sequences for d2geyc1:

Sequence; same for both SEQRES and ATOM records:

>d2geyc1 d.17.4.9 (C:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]}
smaerkalclemvaawnrwdlsgiikhwspdivhysednevssadmvklmegglkafpdl
qlevksimaeedrvalritvtathqgefmgvqptgqrvswhlveelrfvdgkvvehwdvi
nmrpllvrlgklpdvpkvvleasa

Timeline for d2geyc1:

• d2geyc1 first appeared in SCOP 1.75
  
• d2geyc1 appears in SCOPe 2.02
  
• d2geyc1 appears in the current release, SCOPe 2.08, called d2geyc2