Lineage for d2geyc1 (2gey C:2-145)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855675Superfamily d.17.4: NTF2-like [54427] (30 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 855951Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (5 proteins)
  6. 855969Protein Putative hydroxylase AclR [159969] (1 species)
  7. 855970Species Streptomyces galilaeus [TaxId:33899] [159970] (1 PDB entry)
    Uniprot Q1XDX7 2-145
  8. 855972Domain d2geyc1: 2gey C:2-145 [147115]
    automatically matched to 2GEY A:2-145
    complexed with gol, peg, pg4

Details for d2geyc1

PDB Entry: 2gey (more details), 1.8 Å

PDB Description: Crystal Structure of AclR a putative hydroxylase from Streptomyces galilaeus
PDB Compounds: (C:) AclR protein

SCOP Domain Sequences for d2geyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2geyc1 d.17.4.9 (C:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]}
smaerkalclemvaawnrwdlsgiikhwspdivhysednevssadmvklmegglkafpdl
qlevksimaeedrvalritvtathqgefmgvqptgqrvswhlveelrfvdgkvvehwdvi
nmrpllvrlgklpdvpkvvleasa

SCOP Domain Coordinates for d2geyc1:

Click to download the PDB-style file with coordinates for d2geyc1.
(The format of our PDB-style files is described here.)

Timeline for d2geyc1: