![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (6 proteins) |
![]() | Protein Putative hydroxylase AclR [159969] (1 species) |
![]() | Species Streptomyces galilaeus [TaxId:33899] [159970] (1 PDB entry) Uniprot Q1XDX7 2-145 |
![]() | Domain d2geya1: 2gey A:2-145 [147114] Other proteins in same PDB: d2geya2, d2geyc3 complexed with gol, peg, pg4 |
PDB Entry: 2gey (more details), 1.8 Å
SCOPe Domain Sequences for d2geya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]} smaerkalclemvaawnrwdlsgiikhwspdivhysednevssadmvklmegglkafpdl qlevksimaeedrvalritvtathqgefmgvqptgqrvswhlveelrfvdgkvvehwdvi nmrpllvrlgklpdvpkvvleasa
Timeline for d2geya1:
![]() Domains from other chains: (mouse over for more information) d2geyb_, d2geyc2, d2geyc3, d2geyd_ |