SCOPe 2.07: Domain d2geya1: 2gey A:2-145

Lineage for d2geya1 (2gey A:2-145)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (6 proteins)

6. Protein Putative hydroxylase AclR [159969] (1 species)

7. Species Streptomyces galilaeus [TaxId:33899] [159970] (1 PDB entry)
   Uniprot Q1XDX7 2-145

8. Domain d2geya1: 2gey A:2-145 [147114]
   Other proteins in same PDB: d2geya2, d2geyc3
   complexed with gol, peg, pg4

Details for d2geya1

PDB Entry: 2gey, 1.8 Å

PDB Description: Crystal Structure of AclR a putative hydroxylase from Streptomyces galilaeus

PDB Compounds: (A:) AclR protein

SCOPe Domain Sequences for d2geya1:

Sequence; same for both SEQRES and ATOM records:

>d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]}
smaerkalclemvaawnrwdlsgiikhwspdivhysednevssadmvklmegglkafpdl
qlevksimaeedrvalritvtathqgefmgvqptgqrvswhlveelrfvdgkvvehwdvi
nmrpllvrlgklpdvpkvvleasa

Timeline for d2geya1:

• d2geya1 first appeared in SCOP 1.75
  
• d2geya1 appears in SCOPe 2.06
  
• d2geya1 appears in the current release, SCOPe 2.08