Lineage for d2gexb_ (2gex B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504826Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2505360Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2505953Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (6 proteins)
  6. 2505957Protein Nogalamycin biosynthesis protein SnoL [159967] (1 species)
  7. 2505958Species Streptomyces nogalater [TaxId:38314] [159968] (1 PDB entry)
    Uniprot Q9RN64 2-139
  8. 2505960Domain d2gexb_: 2gex B: [147113]
    Other proteins in same PDB: d2gexa2
    automated match to d2gexa1

Details for d2gexb_

PDB Entry: 2gex (more details), 2.5 Å

PDB Description: Crystal structure of SnoaL2 a putative hydroxylase from Streptomyces nogalater
PDB Compounds: (B:) SnoL

SCOPe Domain Sequences for d2gexb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gexb_ d.17.4.9 (B:) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]}
sttankerclemvaawnrwdvsgvvahwapdvvhyddedkpvsaeevvrrmnsaveafpd
lrldvrsivgegdrvmlritcsathqgvfmgiaptgrkvrwtyleelrfseagkvvehwd
vfnfsplfrdlgv

SCOPe Domain Coordinates for d2gexb_:

Click to download the PDB-style file with coordinates for d2gexb_.
(The format of our PDB-style files is described here.)

Timeline for d2gexb_: