![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.9: SnoaL-like polyketide cyclase [102810] (6 proteins) |
![]() | Protein Nogalamycin biosynthesis protein SnoL [159967] (1 species) |
![]() | Species Streptomyces nogalater [TaxId:38314] [159968] (1 PDB entry) Uniprot Q9RN64 2-139 |
![]() | Domain d2gexa1: 2gex A:2-139 [147112] Other proteins in same PDB: d2gexa2 |
PDB Entry: 2gex (more details), 2.5 Å
SCOPe Domain Sequences for d2gexa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]} sttankerclemvaawnrwdvsgvvahwapdvvhyddedkpvsaeevvrrmnsaveafpd lrldvrsivgegdrvmlritcsathqgvfmgiaptgrkvrwtyleelrfseagkvvehwd vfnfsplfrdlgvvpdgl
Timeline for d2gexa1: