Lineage for d2gcxa1 (2gcx A:1-75)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782726Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 2782792Family b.34.1.2: FeoA-like [50041] (5 proteins)
  6. 2782816Protein Ferrous iron transport protein A, FeoA [159014] (1 species)
  7. 2782817Species Klebsiella pneumoniae [TaxId:573] [159015] (1 PDB entry)
    Uniprot A6TF31 1-75
  8. 2782818Domain d2gcxa1: 2gcx A:1-75 [147110]

Details for d2gcxa1

PDB Entry: 2gcx (more details)

PDB Description: solution structure of ferrous iron transport protein a (feoa) of klebsiella pneumoniae
PDB Compounds: (A:) Ferrous iron transport protein A

SCOPe Domain Sequences for d2gcxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gcxa1 b.34.1.2 (A:1-75) Ferrous iron transport protein A, FeoA {Klebsiella pneumoniae [TaxId: 573]}
mqftpdsawkitgfsrdispayrqkllslgmlpgssfhvvrvaplgdpvhietrrvslvl
rkkdlalieleavaq

SCOPe Domain Coordinates for d2gcxa1:

Click to download the PDB-style file with coordinates for d2gcxa1.
(The format of our PDB-style files is described here.)

Timeline for d2gcxa1: