Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) the N-terminal domains of these repressors bind DNA |
Family b.34.1.2: FeoA-like [50041] (5 proteins) |
Protein Ferrous iron transport protein A, FeoA [159014] (1 species) |
Species Klebsiella pneumoniae [TaxId:573] [159015] (1 PDB entry) Uniprot A6TF31 1-75 |
Domain d2gcxa1: 2gcx A:1-75 [147110] |
PDB Entry: 2gcx (more details)
SCOPe Domain Sequences for d2gcxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gcxa1 b.34.1.2 (A:1-75) Ferrous iron transport protein A, FeoA {Klebsiella pneumoniae [TaxId: 573]} mqftpdsawkitgfsrdispayrqkllslgmlpgssfhvvrvaplgdpvhietrrvslvl rkkdlalieleavaq
Timeline for d2gcxa1: