SCOPe 2.08: Domain d2gaxb_: 2gax B:

Lineage for d2gaxb_ (2gax B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.131: Peptidyl-tRNA hydrolase II [102461] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 4 strands, order 2143, strand 4 is antiparallel to the rest

4. Superfamily c.131.1: Peptidyl-tRNA hydrolase II [102462] (2 families)

5. Family c.131.1.1: Peptidyl-tRNA hydrolase II [102463] (5 proteins)
   Pfam PF01981; UPF0099

6. Protein Hypothetical protein Atu0240 [159592] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [159593] (1 PDB entry)
   Uniprot Q8UIQ3 1-135

8. Domain d2gaxb_: 2gax B: [147101]
   automated match to d2gaxa1
   complexed with po4

Details for d2gaxb_

PDB Entry: 2gax, 1.8 Å

PDB Description: structure of protein of unknown function atu0240 from agrobacteriium tumerfaciencs str. c58

PDB Compounds: (B:) hypothetical protein Atu0240

SCOPe Domain Sequences for d2gaxb_:

Sequence; same for both SEQRES and ATOM records:

>d2gaxb_ c.131.1.1 (B:) Hypothetical protein Atu0240 {Agrobacterium tumefaciens [TaxId: 358]}
mfdtkiavilrddlavwqklnvtaflmsgivaqtgeiigepyrdgagnvynplsiqpivv
matdqealrkihqrslerdittslyieemfatghdaanrqvfshfspdtakvvgmalrad
rkivdkitkgaklha

Timeline for d2gaxb_:

• d2gaxb_ first appeared in SCOP 1.75, called d2gaxb1
  
• d2gaxb_ appears in SCOPe 2.07