![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
![]() | Superfamily b.52.1: Barwin-like endoglucanases [50685] (5 families) ![]() |
![]() | Family b.52.1.4: MLTA-like [159195] (1 protein) Pfam PF03562 and Pfam PF06725 cover the middle and C-terminal parts, respectively; contains large insert domain of the L25-like fold (50714) |
![]() | Protein Membrane-bound lytic murein transglycosylase A, MLTA [159196] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [159198] (5 PDB entries) Uniprot P0A935 22-357! Uniprot P0A935 23-357! Uniprot P0A935 24-356 |
![]() | Domain d2gaea1: 2gae A:24-356 [147099] |
PDB Entry: 2gae (more details), 2.5 Å
SCOPe Domain Sequences for d2gaea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gaea1 b.52.1.4 (A:24-356) Membrane-bound lytic murein transglycosylase A, MLTA {Escherichia coli [TaxId: 562]} kptdrgqqykdgkftqpfslvnqpdavgapinagdfaeqinhirnssprlygnqsnvyna vqewlraggdtrnmrqfgidawqmegadnygnvqftgyytpviqarhtrqgefqypiyrm ppkrgrlpsraeiyagalsdkyilaysnslmdnfimdvqgsgyidfgdgsplnffsyagk nghayrsigkvlidrgevkkedmsmqairhwgethseaevrelleqnpsfvffkpqsfap vkgasavplvgrasvasdrsiippgttllaevplldnngkfngqyelrlmvaldvggaik gqhfdiyqgigpeaghragwynhygrvwvlkta
Timeline for d2gaea1: