Lineage for d2gaea1 (2gae A:24-356)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802576Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2802577Superfamily b.52.1: Barwin-like endoglucanases [50685] (5 families) (S)
  5. 2802615Family b.52.1.4: MLTA-like [159195] (1 protein)
    Pfam PF03562 and Pfam PF06725 cover the middle and C-terminal parts, respectively; contains large insert domain of the L25-like fold (50714)
  6. 2802616Protein Membrane-bound lytic murein transglycosylase A, MLTA [159196] (3 species)
  7. 2802619Species Escherichia coli [TaxId:562] [159198] (5 PDB entries)
    Uniprot P0A935 22-357! Uniprot P0A935 23-357! Uniprot P0A935 24-356
  8. 2802627Domain d2gaea1: 2gae A:24-356 [147099]

Details for d2gaea1

PDB Entry: 2gae (more details), 2.5 Å

PDB Description: crystal structure of mlta from e. coli
PDB Compounds: (A:) Membrane-bound lytic murein transglycosylase A

SCOPe Domain Sequences for d2gaea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gaea1 b.52.1.4 (A:24-356) Membrane-bound lytic murein transglycosylase A, MLTA {Escherichia coli [TaxId: 562]}
kptdrgqqykdgkftqpfslvnqpdavgapinagdfaeqinhirnssprlygnqsnvyna
vqewlraggdtrnmrqfgidawqmegadnygnvqftgyytpviqarhtrqgefqypiyrm
ppkrgrlpsraeiyagalsdkyilaysnslmdnfimdvqgsgyidfgdgsplnffsyagk
nghayrsigkvlidrgevkkedmsmqairhwgethseaevrelleqnpsfvffkpqsfap
vkgasavplvgrasvasdrsiippgttllaevplldnngkfngqyelrlmvaldvggaik
gqhfdiyqgigpeaghragwynhygrvwvlkta

SCOPe Domain Coordinates for d2gaea1:

Click to download the PDB-style file with coordinates for d2gaea1.
(The format of our PDB-style files is described here.)

Timeline for d2gaea1: