Lineage for d2g9wb_ (2g9w B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694053Family a.4.5.39: Penicillinase repressor [101016] (4 proteins)
    homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain
    automatically mapped to Pfam PF03965
  6. 2694054Protein Hypothetical protein Rv1846c [158278] (1 species)
    MT1894
  7. 2694055Species Mycobacterium tuberculosis [TaxId:1773] [158279] (1 PDB entry)
    Uniprot P95163 3-124
  8. 2694057Domain d2g9wb_: 2g9w B: [147098]
    automated match to d2g9wa1
    complexed with cl

Details for d2g9wb_

PDB Entry: 2g9w (more details), 1.8 Å

PDB Description: crystal structure of rv1846c, a putative transcriptional regulatory protein of mycobacterium tuberculosis
PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d2g9wb_:

Sequence, based on SEQRES records: (download)

>d2g9wb_ a.4.5.39 (B:) Hypothetical protein Rv1846c {Mycobacterium tuberculosis [TaxId: 1773]}
kltrlgdleravmdhlwsrtepqtvrqvhealsarrdlayttvmavlqrlakknlvlqir
ddrahryapvhgrdelvaglmvdalaqaedsgsrqaalvhfvervgadeadalrralael
ea

Sequence, based on observed residues (ATOM records): (download)

>d2g9wb_ a.4.5.39 (B:) Hypothetical protein Rv1846c {Mycobacterium tuberculosis [TaxId: 1773]}
kltrlgdleravmdhlwsrtepqtvrqvhealsarrdlayttvmavlqrlakknlvlqir
ahryapvhgrdelvaglmvdalaqaedsgsrqaalvhfvervgadeadalrralaelea

SCOPe Domain Coordinates for d2g9wb_:

Click to download the PDB-style file with coordinates for d2g9wb_.
(The format of our PDB-style files is described here.)

Timeline for d2g9wb_: