| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.39: Penicillinase repressor [101016] (4 proteins) homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain automatically mapped to Pfam PF03965 |
| Protein Hypothetical protein Rv1846c [158278] (1 species) MT1894 |
| Species Mycobacterium tuberculosis [TaxId:1773] [158279] (1 PDB entry) Uniprot P95163 3-124 |
| Domain d2g9wb_: 2g9w B: [147098] automated match to d2g9wa1 complexed with cl |
PDB Entry: 2g9w (more details), 1.8 Å
SCOPe Domain Sequences for d2g9wb_:
Sequence, based on SEQRES records: (download)
>d2g9wb_ a.4.5.39 (B:) Hypothetical protein Rv1846c {Mycobacterium tuberculosis [TaxId: 1773]}
kltrlgdleravmdhlwsrtepqtvrqvhealsarrdlayttvmavlqrlakknlvlqir
ddrahryapvhgrdelvaglmvdalaqaedsgsrqaalvhfvervgadeadalrralael
ea
>d2g9wb_ a.4.5.39 (B:) Hypothetical protein Rv1846c {Mycobacterium tuberculosis [TaxId: 1773]}
kltrlgdleravmdhlwsrtepqtvrqvhealsarrdlayttvmavlqrlakknlvlqir
ahryapvhgrdelvaglmvdalaqaedsgsrqaalvhfvervgadeadalrralaelea
Timeline for d2g9wb_: