Lineage for d2g9wa1 (2g9w A:3-124)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762698Family a.4.5.39: Penicillinase repressor [101016] (3 proteins)
    homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain
  6. 762699Protein Hypothetical protein Rv1846c [158278] (1 species)
    MT1894
  7. 762700Species Mycobacterium tuberculosis [TaxId:1773] [158279] (1 PDB entry)
    Uniprot P95163 3-124
  8. 762701Domain d2g9wa1: 2g9w A:3-124 [147097]
    complexed with cl; mutant

Details for d2g9wa1

PDB Entry: 2g9w (more details), 1.8 Å

PDB Description: crystal structure of rv1846c, a putative transcriptional regulatory protein of mycobacterium tuberculosis
PDB Compounds: (A:) conserved hypothetical protein

SCOP Domain Sequences for d2g9wa1:

Sequence, based on SEQRES records: (download)

>d2g9wa1 a.4.5.39 (A:3-124) Hypothetical protein Rv1846c {Mycobacterium tuberculosis [TaxId: 1773]}
kltrlgdleravmdhlwsrtepqtvrqvhealsarrdlayttvmavlqrlakknlvlqir
ddrahryapvhgrdelvaglmvdalaqaedsgsrqaalvhfvervgadeadalrralael
ea

Sequence, based on observed residues (ATOM records): (download)

>d2g9wa1 a.4.5.39 (A:3-124) Hypothetical protein Rv1846c {Mycobacterium tuberculosis [TaxId: 1773]}
kltrlgdleravmdhlwsrtepqtvrqvhealsarrdlayttvmavlqrlakknlvlqir
ahryapvhgrdelvaglmvdalaqaedsgsrqaalvhfvervgadeadalrralaelea

SCOP Domain Coordinates for d2g9wa1:

Click to download the PDB-style file with coordinates for d2g9wa1.
(The format of our PDB-style files is described here.)

Timeline for d2g9wa1: