SCOP 1.75: Domain d2g9wa1: 2g9w A:3-124

Lineage for d2g9wa1 (2g9w A:3-124)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.39: Penicillinase repressor [101016] (3 proteins)
   homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain

6. Protein Hypothetical protein Rv1846c [158278] (1 species)
   MT1894

7. Species Mycobacterium tuberculosis [TaxId:1773] [158279] (1 PDB entry)
   Uniprot P95163 3-124

8. Domain d2g9wa1: 2g9w A:3-124 [147097]
   complexed with cl; mutant

Details for d2g9wa1

PDB Entry: 2g9w, 1.8 Å

PDB Description: crystal structure of rv1846c, a putative transcriptional regulatory protein of mycobacterium tuberculosis

PDB Compounds: (A:) conserved hypothetical protein

SCOP Domain Sequences for d2g9wa1:

Sequence, based on SEQRES records:

>d2g9wa1 a.4.5.39 (A:3-124) Hypothetical protein Rv1846c {Mycobacterium tuberculosis [TaxId: 1773]}
kltrlgdleravmdhlwsrtepqtvrqvhealsarrdlayttvmavlqrlakknlvlqir
ddrahryapvhgrdelvaglmvdalaqaedsgsrqaalvhfvervgadeadalrralael
ea

Sequence, based on observed residues (ATOM records):

>d2g9wa1 a.4.5.39 (A:3-124) Hypothetical protein Rv1846c {Mycobacterium tuberculosis [TaxId: 1773]}
kltrlgdleravmdhlwsrtepqtvrqvhealsarrdlayttvmavlqrlakknlvlqir
ahryapvhgrdelvaglmvdalaqaedsgsrqaalvhfvervgadeadalrralaelea

Timeline for d2g9wa1:

• d2g9wa1 is new in SCOP 1.75
  
• d2g9wa1 appears in SCOPe 2.01
  
• d2g9wa1 appears in the current release, SCOPe 2.08