![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.198.5: YgaC/TfoX-N like [159894] (2 families) ![]() overall similar to the Type III secretory system chaperone subunits; different shape of the beta-sheet |
![]() | Family d.198.5.1: YgaC-like [159895] (1 protein) Pfam PF09400; DUF2002 |
![]() | Protein Putative cytoplasmic protein YgaC [159896] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [159897] (1 PDB entry) Uniprot Q8ZML5 1-112 |
![]() | Domain d2g7ja1: 2g7j A:1-112 [147094] |
PDB Entry: 2g7j (more details)
SCOPe Domain Sequences for d2g7ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g7ja1 d.198.5.1 (A:1-112) Putative cytoplasmic protein YgaC {Salmonella typhimurium [TaxId: 90371]} mylrpdevarvlekagftvdvvtnktygyrrgenyvyvnrearmgrtaliihprlkdrss sladpasdiktcdhyqnfplylggethehygiphgfssrialerylnglfgd
Timeline for d2g7ja1: