Lineage for d2g7ja1 (2g7j A:1-112)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005912Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 3006086Superfamily d.198.5: YgaC/TfoX-N like [159894] (2 families) (S)
    overall similar to the Type III secretory system chaperone subunits; different shape of the beta-sheet
  5. 3006087Family d.198.5.1: YgaC-like [159895] (1 protein)
    Pfam PF09400; DUF2002
  6. 3006088Protein Putative cytoplasmic protein YgaC [159896] (1 species)
  7. 3006089Species Salmonella typhimurium [TaxId:90371] [159897] (1 PDB entry)
    Uniprot Q8ZML5 1-112
  8. 3006090Domain d2g7ja1: 2g7j A:1-112 [147094]

Details for d2g7ja1

PDB Entry: 2g7j (more details)

PDB Description: Solution NMR structure of the putative cytoplasmic protein ygaC from Salmonella typhimurium. Northeast Structural Genomics target StR72.
PDB Compounds: (A:) putative cytoplasmic protein

SCOPe Domain Sequences for d2g7ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g7ja1 d.198.5.1 (A:1-112) Putative cytoplasmic protein YgaC {Salmonella typhimurium [TaxId: 90371]}
mylrpdevarvlekagftvdvvtnktygyrrgenyvyvnrearmgrtaliihprlkdrss
sladpasdiktcdhyqnfplylggethehygiphgfssrialerylnglfgd

SCOPe Domain Coordinates for d2g7ja1:

Click to download the PDB-style file with coordinates for d2g7ja1.
(The format of our PDB-style files is described here.)

Timeline for d2g7ja1: